Skip to content

Global shipping available. Please request a quote to receive customized pricing for your region.

LL-37 (Human) Chemicals Molecular Depot
LL-37 (Human) Chemicals Molecular Depot
LL-37 (Human) Chemicals Molecular Depot
LL-37 (Human) Chemicals Molecular Depot

LL-37 (Human)

$995.00

    Catalog Number: MDP0805 (100 ug)

    LL-37 (Human) is a a 100 µg synthetic human cathelicidin antimicrobial peptide supplied as a lyophilized powder (MW 4493.2 g/mol). This multifunctional peptide exhibits broad-spectrum antimicrobial activity, immunomodulatory effects, wound healing properties, and anti-inflammatory actions. Essential for research in innate immunity, infection, inflammation, and oncology. Custom bulk amounts of this product are available upon request.

    Products are for in vitro research use only (RUO).

    Live Inquiry about this product via:

    Email: info@bluetigerscientific.com

    Text/SMS: (833) 928-4437 Mon–Fri, (8 am – 8 pm PST)

See All Specs

aeroplane.png__PID:119d4b1a-2623-400c-8fa4-aec5b49a3bf0

Fast Delivery

Most items ship same day

protection.png__PID:4b1a2623-e00c-4fa4-aec5-b49a3bf05f92

Manufacturer Warranty

All products are covered by manufacturer warranty

technical-support.png__PID:e00c8fa4-aec5-449a-bbf0-5f923431936b

After-Sale Support

24/7 support

For Purchasing Details Or COA/TDS Availability, Please Request A Quote 👇.

LL-37 (Human) – Research Use Only

LL-37 (Human) is a 37-amino acid cationic antimicrobial peptide (human cathelicidin) supplied as a 100 µg lyophilized powder (Catalog #MDP0805, MW 4493.2 g/mol). This biotechnology-grade peptide plays a central role in innate immunity, exhibiting broad-spectrum antimicrobial activity, immunomodulatory functions, and involvement in wound healing, inflammation regulation, and anti-cancer effects.

Catalog number: MDP0805
CAS Number: N/A
Sequence: Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser
Amount: 100 µg
Molecular Weight: 4493.2 g/mol
Supplied as: Powder
Applications: Antimicrobial activity studies, immunomodulation, wound healing, inflammation research, anti-cancer mechanisms, and innate immunity
Storage: -20 °C
WARNING: For in vitro Research Use Only. NOT for use on humans or animals.
Grade: Biotechnology grade. All products are highly pure.

Scientific Overview

LL-37 is the only known human member of the cathelicidin family of antimicrobial peptides. It is proteolytically cleaved from the precursor protein hCAP18 and exhibits potent broad-spectrum antimicrobial activity against bacteria, viruses, fungi, and parasites. Beyond direct microbicidal effects, LL-37 modulates immune responses, promotes wound healing and angiogenesis, regulates inflammation, and exhibits anti-tumor activity in various models. Its multifunctional nature makes it a key research target in innate immunity, infectious diseases, chronic inflammation, and oncology.

This LL-37 (Human) is suitable for:

  • Antimicrobial and anti-biofilm activity studies
  • Immunomodulation and inflammation research
  • Wound healing and tissue repair models
  • Anti-cancer and angiogenesis studies
  • Innate immunity and host defense mechanism investigations

Usage & Handling Guidance

Store the lyophilized powder at -20 °C. Reconstitute in sterile ultrapure water or appropriate buffer (e.g., PBS or 0.1% acetic acid) to the desired concentration. Prepare single-use aliquots to avoid repeated freeze–thaw cycles. The peptide is sensitive to proteases; use protease-free conditions when possible.

  • Recommended applications: Antimicrobial assays, cell-based immunomodulation studies, and wound healing models
  • Working concentration: Typically 1–50 µM (optimize for specific assay and cell type)
  • Stability: Lyophilized form is stable at -20 °C; reconstituted solutions should be used promptly or stored frozen
  • Handling: Use sterile techniques; protect from repeated freeze–thaw cycles

What You Get

  • 100 µg synthetic human LL-37 peptide as lyophilized powder
  • Full-length 37-amino acid sequence ([LL-37, 37 aa])
  • Molecular weight 4493.2 g/mol
  • High-purity biotechnology-grade material for sensitive biological assays
  • For research use only (RUO)

Why Researchers Choose It

  • Authentic human cathelicidin LL-37 with full biological sequence
  • Multifunctional peptide with potent antimicrobial, immunomodulatory, and wound-healing properties
  • Essential tool for innate immunity, infection, inflammation, and cancer research
  • High-purity lyophilized format ensures stability and reproducibility
  • Well-documented in thousands of studies across multiple disciplines

Frequently Asked Questions (FAQ)

  • What is LL-37?
    LL-37 is the active form of the only human cathelicidin antimicrobial peptide, derived from the precursor hCAP18.
  • What are its main biological activities?
    It has direct antimicrobial effects, modulates immune responses, promotes wound healing and angiogenesis, and exhibits anti-inflammatory and anti-tumor properties.
  • How should I reconstitute the powder?
    Dissolve in sterile ultrapure water, PBS, or 0.1% acetic acid. Prepare aliquots and store at -20 °C to avoid repeated freeze–thaw cycles.
  • What concentration is typically used in experiments?
    Working concentrations usually range from 1–50 µM depending on the assay (optimize empirically).
  • Is this suitable for in vivo studies?
    This product is for research use only (RUO) and not intended for therapeutic or clinical applications.
This product is for Research Use Only (RUO). It is not intended for diagnostic or therapeutic use in humans or animals.

References

  • Chen X, Zou X, Qi G, Tang Y, Guo Y, Si J, Liang L. Roles and Mechanisms of Human Cathelicidin LL-37 in Cancer. Cell Physiol Biochem. 2018;47(3):1060-1073. Reference
  • Wang G, Narayana JL, Mishra B, Zhang Y, Wang F, Wang C, Zarena D, Lushnikova T, Wang X. Design of Antimicrobial Peptides: Progress Made with Human Cathelicidin LL-37. Adv Exp Med Biol. 2019;1117:215-240. Reference
  • Ridyard KE, Overhage J. The Potential of Human Peptide LL-37 as an Antimicrobial and Anti-Biofilm Agent. Antibiotics (Basel). 2021 May 29;10(6):650. Reference
  • Aloul KM, Nielsen JE, Defensor EB, Lin JS, Fortkort JA, Shamloo M, Cirillo JD, Gombart AF, Barron AE. Upregulating Human Cathelicidin Antimicrobial Peptide LL-37 Expression May Prevent Severe COVID-19 Inflammatory Responses and Reduce Microthrombosis. Front Immunol. 2022 May 12;13:880961. Reference
  • Wei X, Zhang L, Yang Y, Hou Y, Xu Y, Wang Z, Su H, Han F, Han J, Liu P, Hu S, Koci MD, Sun X, Zhang C. LL-37 transports immunoreactive cGAMP to activate STING signaling and enhance interferon-mediated host antiviral immunity. Cell Rep. 2022 May 31;39(9):110880. Reference
  • Jacobsen AS, Jenssen H. Human cathelicidin LL-37 prevents bacterial biofilm formation. Future Med Chem. 2012 Aug;4(12):1587-99. Reference
  • Suzuki K, Ohkuma M, Someya A, Mita T, Nagaoka I. Human Cathelicidin Peptide LL-37 Induces Cell Death in Autophagy-Dysfunctional Endothelial Cells. J Immunol. 2022 May 1;208(9):2163-2172. Reference
  • Méndez-Samperio P. The human cathelicidin hCAP18/LL-37: a multifunctional peptide involved in mycobacterial infections. Peptides. 2010 Sep;31(9):1791-8. Reference
  • Chieosilapatham P, Ikeda S, Ogawa H, Niyonsaba F. Tissue-specific Regulation of Innate Immune Responses by Human Cathelicidin LL-37. Curr Pharm Des. 2018;24(10):1079-1091. Reference
  • Sánchez-Peña FJ, Romero-Tlalolini MLÁ, Torres-Aguilar H, Cruz-Hernández DS, Baltiérrez-Hoyos R, Sánchez-Aparicio SR, Aquino-Domínguez AS, Aguilar-Ruiz SR. LL-37 Triggers Antimicrobial Activity in Human Platelets. Int J Mol Sci. 2023 Feb 1;24(3):2816. Reference

    Terms & Conditions

    Blue Tiger Scientific is an independent third-party distributor of select products manufactured by Molecular Depot LLC. By purchasing from bluetigerscientific.com, you (“the Customer”) agree to the following terms, adapted from Molecular Depot’s original conditions:

    Product Use & Eligibility
    Products are for in vitro research use only (RUO). They are not intended for human or animal use, diagnosis, therapy, resale to consumers, or residential delivery. Sales are limited to verified business addresses.

    Payment Terms
    All purchases are prepaid and non-refundable once confirmed. Pricing is in USD and subject to change without notice.

    Purchase Orders
    Confirmed orders are final and may not be canceled or refunded unless authorized in writing.

    Limitation of Liability
    Blue Tiger Scientific and Molecular Depot LLC are not responsible for any damages resulting from product use or misuse.

    Waiver of Claims
    By ordering, you waive all claims arising from use of Molecular Depot products.

    Shipping & Handling
    Shipping is calculated at checkout. A minimum 27% handling fee applies to each order.

    Delivery Estimates All delivery timelines are estimates and not guaranteed. FedEx service levels are subject to operational delays, weather disruptions, and regional restrictions.

    FedEx Pickup Cutoff Orders submitted after the daily FedEx pickup window may not ship until the next available pickup day.

    Shipping Exceptions FedEx may impose restrictions or delays due to package size, weight, destination, or service availability. Blue Tiger Scientific is not liable for delays beyond our control.

    Weekend & Holiday Handling Orders placed on weekends or holidays will be processed on the next business day.

    Returns & Refunds
    Returns must be requested within 30 days through Blue Tiger Scientific. Refunds are only issued for shipping errors or verified defects, and processed within 45 business days if approved. Customers are responsible for return shipping costs unless otherwise stated. Refunds will exclude original shipping fees paid at checkout.

    Warranty Disclaimer
    All products are provided "as-is" with no warranties. Warranty issues are handled by the manufacturer.

    Safety Guidelines
    Always consult the product’s SDS. Products must not be ingested, inhaled, or come into contact with skin or eyes unless specified.

    Legal Use Compliance
    Products must not be used in violation of any law—local, state, federal, or international.

    Accuracy of Orders
    Customers are responsible for verifying all order details before submission.

    Changes or Cancellations
    All changes must be in writing and approved. Cancellations may result in fees for materials, labor, or third-party costs.

    Quality System (MD Levels)
    Molecular Depot’s MD-Quality System includes:

    MD 1000: Non-regulated use, no change notification

    MD 2000: Non-regulated use, limited change notification

    MD 3000: Regulated use, enhanced quality standards

    Delivery & Claims
    Orders may ship in parts. Claims for shortages or defects must be submitted within 2 days of receipt. Delivery dates are estimates only.

    Extended Payment Terms
    Payment is due within 30 days unless agreed otherwise. A 5% weekly penalty applies to late payments. Blue Tiger Scientific reserves discretion on payment application.

    Retention of Title
    Ownership remains with Blue Tiger Scientific or Molecular Depot LLC until payment is complete. Goods must be stored separately and labeled until paid in full.

    Intellectual Property
    No rights to manufacturing processes or IP are transferred. Blue Tiger Scientific is not liable for IP-related claims.

    Force Majeure
    Neither party is liable for delays or failures caused by uncontrollable events (e.g., weather, regulations, supply disruptions).

    Manufacturing Access
    Product purchase does not grant access to proprietary manufacturing documents or methods.

    Resale Prohibition
    Products cannot be resold without written approval from Molecular Depot LLC. Blue Tiger Scientific enforces this restriction.

    Governing Law
    Terms are governed by California and U.S. law. All disputes fall under U.S. jurisdiction.

Questions about a product? Ask us here.

email us here: info@bluetigerscientific.com or live chat