Skip to content

Global shipping available. Please request a quote to receive customized pricing for your region.

Glucagon (1 - 29) (Bovine, Human, Porcine) - FAM labeled Peptides Molecular Depot
Glucagon (1 - 29) (Bovine, Human, Porcine) - FAM labeled Peptides Molecular Depot

Glucagon (1 - 29) (Bovine, Human, Porcine) - FAM labeled

$795.00

    Catalog Number: B2019509 (1 mg)

    Glucagon (1-29) is a fluorescently tagged peptide hormone derived from proglucagon, produced in pancreatic alpha cells. It raises blood glucose levels by promoting gluconeogenesis and glycogenolysis. This product has been used as a molecular tool for various biochemical applications. It has also been used in a wide array of other chemical and immunological applications. Custom bulk amounts of this product are available upon request.

    Products are for in vitro research use only (RUO).

    Live Inquiry about this product via:

    Email: info@bluetigerscientific.com

    Text/SMS: (833) 928-4437 Mon–Fri, (8 am – 8 pm PST)

See All Specs

aeroplane.png__PID:119d4b1a-2623-400c-8fa4-aec5b49a3bf0

Fast Delivery

Most items ship same day

protection.png__PID:4b1a2623-e00c-4fa4-aec5-b49a3bf05f92

Manufacturer Warranty

All products are covered by manufacturer warranty

technical-support.png__PID:e00c8fa4-aec5-449a-bbf0-5f923431936b

After-Sale Support

24/7 support

For Purchasing Details Or COA/TDS Availability, Please Request A Quote 👇.

Glucagon (1 - 29) (Bovine, Human, Porcine) - FAM labeled

Catalog number: B2019509
Lot number: Batch Dependent
Expiration Date: Batch dependent
Amount: 1 mg
Molecular Weight or Concentration: 3841.1
Supplied as: Powder
Applications: a molecular tool for various biochemical applications
Storage: -20°C
Keywords: FAM-HSQGTFTSDYSKYLDSRRAQDFVQWLMNT
Grade: Biotechnology grade. All products are highly pure. All solutions are made with Type I ultrapure water (resistivity >18 MΩ-cm) and are filtered through 0.22 um.

References

  • Gandasi NR, Gao R, Kothegala L, Pearce A, Santos C, Acreman S, Basco D, Benrick A, Chibalina MV, Clark A, Guida C, Harris M, Johnson PRV, Knudsen JG, Ma J, Miranda C, Shigeto M, Tarasov AI, Yeung HY, Thorens B, Asterholm IW, Zhang Q, Ramracheya R, Ladds G, Rorsman P. GLP-1 metabolite GLP-1(9-36) is a systemic inhibitor of mouse and human pancreatic islet glucagon secretion Diabetologia. 2024 Mar;67(3):528-546.
  • Krishna Kumar K, O’Brien ES, Habrian CH, Latorraca NR, Wang H, Tuneew I, Montabana E, Marqusee S, Hilger D, Isacoff EY, Mathiesen JM, Kobilka BK. Negative allosteric modulation of the glucagon receptor by RAMP2 Cell. 2023 Mar 30;186(7):1465-1477.e18.
  • Petrenko V, Dibner C. Cell-specific resetting of mouse islet cellular clocks by glucagon, glucagon-like peptide 1 and somatostatin Acta Physiol (Oxf). 2018 Apr;222(4):e13021.
  • Heithier H, Ward LD, Cantrill RC, Klein HW, Im MJ, Pollak G, Freeman B, Schiltz E, Peters R, Helmreich EJ. Fluorescent glucagon derivatives. I. Synthesis and characterisation of fluorescent glucagon derivatives Biochim Biophys Acta. 1988 Oct 7;971(3):298-306.
  • Chen W, Cui W, Wu J, Zheng W, Sun X, Zhang J, Shang H, Yuan Y, Li X, Wang J, Hu X, Chen L, Zeng F, Xiao RP, Zhang X. Blocking IL-6 signaling improves glucose tolerance via SLC39A5-mediated suppression of glucagon secretion Metabolism. 2023 Sep;146:155641.
  • Roed SN, Nøhr AC, Wismann P, Iversen H, Bräuner-Osborne H, Knudsen SM, Waldhoer M. Functional consequences of glucagon-like peptide-1 receptor cross-talk and trafficking J Biol Chem. 2015 Jan 9;290(2):1233-43.
  • Dalle S, Fontés G, Lajoix AD, LeBrigand L, Gross R, Ribes G, Dufour M, Barry L, LeNguyen D, Bataille D. Miniglucagon (glucagon 19-29): a novel regulator of the pancreatic islet physiology Diabetes. 2002 Feb;51(2):406-12.
  • Hui H, Wright C, Perfetti R. Glucagon-like peptide 1 induces differentiation of islet duodenal homeobox-1-positive pancreatic ductal cells into insulin-secreting cells Diabetes. 2001 Apr;50(4):785-96.
  • Urusova IA, Farilla L, Hui H, D’Amico E, Perfetti R. GLP-1 inhibition of pancreatic islet cell apoptosis Trends Endocrinol Metab. 2004 Jan-Feb;15(1):27-33.

    Terms & Conditions

    Blue Tiger Scientific is an independent third-party distributor of select products manufactured by Molecular Depot LLC. By purchasing from bluetigerscientific.com, you (“the Customer”) agree to the following terms, adapted from Molecular Depot’s original conditions:

    Product Use & Eligibility
    Products are for in vitro research use only (RUO). They are not intended for human or animal use, diagnosis, therapy, resale to consumers, or residential delivery. Sales are limited to verified business addresses.

    Payment Terms
    All purchases are prepaid and non-refundable once confirmed. Pricing is in USD and subject to change without notice.

    Purchase Orders
    Confirmed orders are final and may not be canceled or refunded unless authorized in writing.

    Limitation of Liability
    Blue Tiger Scientific and Molecular Depot LLC are not responsible for any damages resulting from product use or misuse.

    Waiver of Claims
    By ordering, you waive all claims arising from use of Molecular Depot products.

    Shipping & Handling
    Shipping is calculated at checkout. A minimum 27% handling fee applies to each order.

    Delivery Estimates All delivery timelines are estimates and not guaranteed. FedEx service levels are subject to operational delays, weather disruptions, and regional restrictions.

    FedEx Pickup Cutoff Orders submitted after the daily FedEx pickup window may not ship until the next available pickup day.

    Shipping Exceptions FedEx may impose restrictions or delays due to package size, weight, destination, or service availability. Blue Tiger Scientific is not liable for delays beyond our control.

    Weekend & Holiday Handling Orders placed on weekends or holidays will be processed on the next business day.

    Returns & Refunds
    Returns must be requested within 30 days through Blue Tiger Scientific. Refunds are only issued for shipping errors or verified defects, and processed within 45 business days if approved. Customers are responsible for return shipping costs unless otherwise stated. Refunds will exclude original shipping fees paid at checkout.

    Warranty Disclaimer
    All products are provided "as-is" with no warranties. Warranty issues are handled by the manufacturer.

    Safety Guidelines
    Always consult the product’s SDS. Products must not be ingested, inhaled, or come into contact with skin or eyes unless specified.

    Legal Use Compliance
    Products must not be used in violation of any law—local, state, federal, or international.

    Accuracy of Orders
    Customers are responsible for verifying all order details before submission.

    Changes or Cancellations
    All changes must be in writing and approved. Cancellations may result in fees for materials, labor, or third-party costs.

    Quality System (MD Levels)
    Molecular Depot’s MD-Quality System includes:

    MD 1000: Non-regulated use, no change notification

    MD 2000: Non-regulated use, limited change notification

    MD 3000: Regulated use, enhanced quality standards

    Delivery & Claims
    Orders may ship in parts. Claims for shortages or defects must be submitted within 2 days of receipt. Delivery dates are estimates only.

    Extended Payment Terms
    Payment is due within 30 days unless agreed otherwise. A 5% weekly penalty applies to late payments. Blue Tiger Scientific reserves discretion on payment application.

    Retention of Title
    Ownership remains with Blue Tiger Scientific or Molecular Depot LLC until payment is complete. Goods must be stored separately and labeled until paid in full.

    Intellectual Property
    No rights to manufacturing processes or IP are transferred. Blue Tiger Scientific is not liable for IP-related claims.

    Force Majeure
    Neither party is liable for delays or failures caused by uncontrollable events (e.g., weather, regulations, supply disruptions).

    Manufacturing Access
    Product purchase does not grant access to proprietary manufacturing documents or methods.

    Resale Prohibition
    Products cannot be resold without written approval from Molecular Depot LLC. Blue Tiger Scientific enforces this restriction.

    Governing Law
    Terms are governed by California and U.S. law. All disputes fall under U.S. jurisdiction.

Questions about a product? Ask us here.

email us here: info@bluetigerscientific.com or live chat